Easy Garlic Parmesan Knots - 20 Min Prep
30-MINUTE MEALS! Get the email series now
Yummique

Easy Garlic Parmesan Knots

5 from 1 vote
1 Comments
Amira
By: AmiraUpdated: Aug 14, 2026
This post may contain affiliate links. Please read our disclosure policy.

Fool-proof, buttery garlic knots made from refrigerated buttermilk biscuits—ready in under 20 minutes and perfect for weeknights, parties, or as a side.

Easy Garlic Parmesan Knots
This recipe started as a last-minute fix the first time I needed something warm and garlicky to serve alongside a simple tomato soup. I discovered that a tube of refrigerated buttermilk biscuits, a little melted butter and a handful of pantry herbs could transform into soft, golden knots that disappear faster than you can say "seconds." These garlic parmesan knots are one of those easy wins that feel like comfort food but take almost no effort. The exterior browns quickly in a hot oven while the interior stays pillowy, and the garlic-parmesan butter soaks in just enough to make every bite fragrant and savory. What makes this preparation special is the balance of textures and flavors: a slightly crisp outside, tender inside, and a glossy, buttery coating with a gentle tang from freshly grated Parmesan. I first made them on a cold weeknight when I had guests and no time to bake from scratch. The recipe turned out so well that it became our go-to when time is short but we want something fresh from the oven. Kids love the fun knot shape, adults appreciate the garlic and herb punch, and nobody gets upset when I pop another tray into the oven.

Why You'll Love This Recipe

  • Ready in less than 20 minutes from start to finish, perfect for impromptu gatherings or busy weeknights when you want something freshly baked without fuss.
  • Uses a single tube of refrigerated buttermilk biscuits, so there is no dough rising or advanced prep; pantry staples like garlic powder and dried herbs keep it budget-friendly.
  • The Parmesan and butter coat every knot for a savory, slightly salty finish that pairs beautifully with soups, salads, and pasta or stands alone as a snack.
  • Make-ahead friendly: you can tie the knots and store them in the fridge for up to 24 hours before baking; they retain their shape and bake evenly when chilled.
  • Superior crowd appeal: the portion size is easy to scale, and the knots are handheld and shareable, making them ideal for family dinners, potlucks or game day.

I still remember the first time I pulled a tray from the oven and handed a warm knot to my partner; the smile said it all. Over the years I have tweaked the herb blend and found that a touch of dried oregano and parsley gives a familiar Italian flavor without overpowering the butter. Guests always ask for the recipe, and I love how it turns a humble biscuit tube into something memorable.

Ingredients

  • Unsalted butter: 1/4 cup melted (4 tablespoons). Use a good-quality butter for best flavor; I often use Land O Lakes or Kerrygold when I have it on hand. Melting it allows the herbs and Parmesan to disperse evenly.
  • Freshly grated Parmesan: 2 tablespoons. Freshly grated offers better texture and flavor than pre-grated powder; look for Parmigiano-Reggiano at the grocery store for a nuttier finish.
  • Garlic powder: 3/4 teaspoon. Garlic powder gives an even garlic flavor without the risk of raw garlic burning in the oven; adjust to taste if you prefer a stronger profile.
  • Dried oregano: 1/2 teaspoon. A little oregano adds a warm, savory note; substitute Italian seasoning if that’s what you have.
  • Dried parsley flakes: 1/2 teaspoon. Parsley brightens the butter and adds color; fresh parsley could be sprinkled after baking for a fresh hit.
  • Salt: 1/4 teaspoon. A small amount of salt balances the butter and Parmesan; reduce if your cheese is very salty.
  • Refrigerated buttermilk biscuits: 1 (16-ounce) tube, typically eight biscuits. I usually buy the Pillsbury Grands or a store-brand buttermilk tube for reliable shape and texture.

Instructions

Preheat and prepare the pan: Preheat the oven to 400 degrees F. Lightly oil a baking sheet or coat it with nonstick spray so the knots don’t stick and release easily when they brown. Position the oven rack in the center for even color. Allow the oven to fully come to temperature before baking so the biscuits brown in the allotted time. Make the garlic-parmesan butter: In a small bowl, whisk together 1/4 cup melted butter, 2 tablespoons freshly grated Parmesan, 3/4 teaspoon garlic powder, 1/2 teaspoon dried oregano, 1/2 teaspoon dried parsley flakes and 1/4 teaspoon salt. Set aside about half of this mixture for brushing after baking. The residual heat from the biscuits will help melt the cheese into the butter for a glossy finish. Shape the knots: Halve each of the 8 biscuits to make 16 pieces. On a lightly floured surface or between two palms, roll each piece into a 5-inch rope about 1/2-inch thick. Tie each rope into a simple knot, tucking the ends underneath to keep the shape. The knots should be snug but not tight so the center remains tender. Brush and bake: Place knots on the prepared baking sheet leaving a little space for expansion. Brush each knot with about half of the butter mixture—this helps them brown and infuses flavor. Bake in the 400 degrees F oven until golden brown, about 8 to 10 minutes. Look for an even golden color on top and avoid overbaking to keep interiors soft. Finish and serve: Remove from the oven and immediately brush knots with the reserved butter mixture for added gloss and flavor. Serve warm. These are best the same day but can be refreshed (see Storage Tips). Freshly baked garlic parmesan knots on a baking sheet

You Must Know

  • These knots freeze well unbaked for up to 1 month; thaw in the refrigerator overnight before baking and add a couple of extra minutes to the bake time.
  • High in comfort-carbs and butter; each knot is a satisfying side—approximately 190 calories per serving depending on biscuit brand and exact butter used.
  • Store leftovers in an airtight container in the refrigerator for up to 3 days; reheat at 350 degrees F for 5 to 7 minutes to refresh crispness.
  • Use a thermometer if unsure: the interior of fully baked knots should be around 190 to 200 degrees F when tested in the thickest part.

My favorite part of this method is the speed and consistency. The first time I tried these for a neighborhood potluck everyone assumed I’d made dough from scratch. Another memory is making a double batch for a movie night; the knots were gone within minutes and people kept remarking how buttery and fresh they tasted. The simplicity of rolling and knotting makes the process oddly meditative, and it’s a great recipe to teach kids basic shaping skills in the kitchen.

Close-up of garlic parmesan knots with melted butter

Storage Tips

Store cooled knots in an airtight container or resealable bag in the refrigerator for up to 3 days. For longer storage, place unbaked knots in a single layer on a tray, freeze until firm, then transfer to a freezer bag for up to 1 month. To reheat refrigerated knots, preheat the oven to 350 degrees F and warm for 5 to 7 minutes; this refreshes the exterior while keeping the center tender. For frozen unbaked knots, bake from chilled adding 3 to 5 minutes to the original time. Avoid microwaving for best texture; the microwave makes them gummy rather than crisp.

Ingredient Substitutions

If you prefer a stronger garlic hit, swap 3/4 teaspoon garlic powder for 1 teaspoon garlic powder or mix in 1/2 teaspoon garlic salt but reduce the added salt. Use shredded Pecorino Romano in place of Parmesan for a sharper, saltier edge. For a dairy-free option, substitute vegan butter and omit the cheese or use a dairy-free grated alternative; note that flavor and browning will differ slightly. If you only have canned biscuits with a different size, adjust knot size and bake time accordingly—smaller knots may only need 6 to 8 minutes.

Serving Suggestions

Serve warm alongside a bowl of tomato soup, a crisp green salad, or as an accompaniment to pasta dishes like spaghetti aglio e olio. They make a great appetizer on a grazing board with marinated olives, cured meats and roasted red peppers. Garnish with a sprinkle of freshly chopped parsley and an extra dusting of Parmesan for presentation. For dipping, offer marinara, pesto, or a lemony garlic butter for contrast.

Cultural Background

Knotted bread shapes are common in many cuisines, but these garlic parmesan knots are an Americanized quick version inspired by classic Italian garlic knots typically made from pizza dough. The tradition of knotting bread dates back centuries in Mediterranean baking where shapes signaled region or occasion. This easy method keeps the spirit of that tradition while relying on convenient refrigerated biscuits to produce a bakery-style result in minutes.

Seasonal Adaptations

In spring, add a tablespoon of finely chopped fresh basil to the butter for a bright, herbaceous finish. For autumn, mix a pinch of smoked paprika into the butter to pair with heartier soups. During winter holidays, top with a light dusting of flaky sea salt and swap parsley for chopped fresh rosemary for a festive aroma. These small swaps adapt the knots to any menu or season while keeping the core technique unchanged.

Meal Prep Tips

Prepare knots in bulk by shaping and placing them on baking sheets lined with parchment, then wrap and refrigerate for up to 24 hours. When ready to bake, brush with butter and bake as directed. For grab-and-go meals, freeze unbaked knots on trays until solid and then package; bake straight from frozen adding a few minutes. Individually portioning into small containers makes them an easy side for packed lunches or potluck platters.

These buttery garlic parmesan knots are proof that short ingredient lists can produce memorable results. Whether you bake a single tray for dinner or multiples for a party, the method is forgiving, fast and endlessly adaptable. Give them a try and make the shaping step your own—once you master the knot, you may never reach for store-bought rolls again.

Pro Tips

  • Brush knots with reserved butter immediately after baking to ensure glossy, flavorful tops.

  • If knots brown too quickly, reduce oven temperature by 25 degrees and extend baking time by a few minutes for even cooking.

  • For a fresher herb flavor, sprinkle 1 tablespoon chopped fresh parsley over the knots after baking.

  • Freeze unbaked knots on a tray until firm, then transfer to a freezer bag for up to 1 month.

This nourishing easy garlic parmesan knots recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Vegetarianrecipesappetizerssnacksgarlicparmesanweeknight-dinnerkid-friendly
No ratings yet

Easy Garlic Parmesan Knots

This Easy Garlic Parmesan Knots recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 16 steaks
Easy Garlic Parmesan Knots
Prep:10 minutes
Cook:10 minutes
Rest Time:10 mins
Total:20 minutes

Instructions

1

Preheat and prepare the pan

Preheat the oven to 400 degrees F. Lightly oil a baking sheet or use nonstick spray and position the rack in the center for even browning.

2

Make the garlic-parmesan butter

In a small bowl whisk together melted butter, grated Parmesan, garlic powder, oregano, parsley flakes and salt. Reserve about half of the mixture for finishing after baking.

3

Shape the knots

Halve each biscuit into two pieces. Roll each piece into a 5-inch rope about 1/2-inch thick and tie into a knot, tucking ends underneath so they hold shape during baking.

4

Brush and bake

Place knots on the prepared baking sheet, brush with half the butter mixture, and bake 8 to 10 minutes until golden brown. Remove and immediately brush with the reserved butter.

5

Serve warm

Serve immediately for the best texture and flavor. Reheat leftovers in a 350 degrees F oven for 5 to 7 minutes to refresh crispness.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 190kcal | Carbohydrates: 20g | Protein:
3g | Fat: 9g | Saturated Fat: 3g |
Polyunsaturated Fat: 2g | Monounsaturated Fat:
4g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@yummique on social media!

Easy Garlic Parmesan Knots

Categories:

Easy Garlic Parmesan Knots

Did You Make This?

Leave a comment & rating below or tag @yummique on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Amira!

Chef and recipe creator specializing in delicious Vegetarian cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.